ATP10D Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ATP10D antibody: synthetic peptide directed towards the C terminal of human ATP10D. Synthetic peptide located within the following region: LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	160 kDa
Gene Name	ATPase phospholipid transporting 10D (putative)
Database Link	NP_065186 Entrez Gene 57205 Human UniProt ID Q9P241
Background	ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily. The exact function of ATP10D remains unknown.
Synonyms	ATPVD
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 92%; Rat: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%; Bovine: 86%; Mouse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.