SEMA4A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SEMA4A Antibody: synthetic peptide directed towards the N terminal of human SEMA4A. Synthetic peptide located within the following region: PSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	84 kDa
Gene Name	semaphorin 4A
Database Link	NP_071762 Entrez Gene 64218 Human UniProt ID Q9H3S1
Background	SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses.
Synonyms	CORD10; RP35; SEMAB; SEMB
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Pig: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Axon guidance

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.