ZNF313 (RNF114) (NM_018683) Human Recombinant Protein
CAT#: TP309752
Recombinant protein of human ring finger protein 114 (RNF114), 20 µg
View other "ZNF313" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209752 protein sequence
Red=Cloning site Green=Tags(s) MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD VDEEDMMNQVLQRSIIDQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061153 |
Locus ID | 55905 |
UniProt ID | Q9Y508 |
Refseq Size | 2478 |
Cytogenetics | 20q13.13 |
Refseq ORF | 684 |
Synonyms | PSORS12; ZNF313 |
Summary | E3 ubiquitin-protein ligase promoting the ubiquitination and degradation of the CDK inhibitor CDKN1A and probably also CDKN1B and CDKN1C. These activities stimulate cell cycle's G1-to-S phase transition and suppress cellular senescence. May play a role in spermatogenesis.[UniProtKB/Swiss-Prot Function] |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Chemoproteomics-enabled discovery of covalent RNF114-based degraders that mimic natural product function
,Luo, M;Spradlin, JN;Boike, L;Tong, B;Brittain, SM;McKenna, JM;Tallarico, JA;Schirle, M;Maimone, TJ;Nomura, DK;,
Cell chemical biology
,PubMed ID 33513350
[RNF114]
|
Chemoproteomics-Enabled Ligand Screening Yields Covalent RNF114-Based Degraders that Mimic Natural Product Function
,Luo, M;Spradlin, J;Brittain, S;McKenna, J;Tallarico, J;Schirle, M;Maimone, T;Nomura, D;,
bioRxiv
[RNF114]
|
Harnessing the Anti-Cancer Natural Product Nimbolide for Targeted Protein Degradation
,null,
Nature chemical biology
,PubMed ID 31209351
[RNF114]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412984 | RNF114 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412984 | Transient overexpression lysate of ring finger protein 114 (RNF114) |
CNY 3,080.00 |
|
PH309752 | RNF114 MS Standard C13 and N15-labeled recombinant protein (NP_061153) |
CNY 19,520.00 |