IRF3 (NM_001197128) Human Tagged ORF Clone

CAT#: RG233320

  • TrueORF®

IRF3 (tGFP-tagged) - Homo sapiens interferon regulatory factor 3 (IRF3), transcript variant 8

ORF Plasmid: DDK tGFP



  "NM_001197128" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Anti-IRF3 mouse monoclonal antibody, clone OTI5D2 (formerly 5D2)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms IIAE7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG233320 representing NM_001197128
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTTGGCCCCACTCCCAGATCCGGGACCCCCAAGCCTGGCTGTAGCCCCTGAGCCCTGCCCTCAGC
CCCTGCGGAGCCCCAGCTTGGACAATCCCACTCCCTTCCCAAACCTGGGGCCCTCTGAGAACCCACTGAA
GCGGCTGTTGGTGCCGGGGGAAGATCTGATTACCTTCACGGAAGGAAGCGGACGCTCACCACGCTATGCC
CTCTGGTTCTGTGTGGGGGAGTCATGGCCCCAGGACCAGCCGTGGACCAAGAGGCTCGTGATGGTCAAGG
TTGTGCCCACGTGCCTCAGGGCCTTGGTAGAAATGGCCCGGGTAGGGGGTGCCTCCTCCCTGGAGAATAC
TGTGGACCTGCACATTTCCAACAGCCACCCACTCTCCCTCACCTCCGACCAGTACAAGGCCTACCTGCAG
GACTTGGTGGAGGGCATGGATTTCCAGGGCCCTGGGGAGAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG233320 representing NM_001197128
Red=Cloning site Green=Tags(s)

MVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEDLITFTEGSGRSPRYA
LWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQ
DLVEGMDFQGPGES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001197128
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001197128.2
RefSeq Size 900 bp
RefSeq ORF 465 bp
Locus ID 3661
UniProt ID Q14653
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Gene Summary This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. The protein plays an important role in the innate immune response against DNA and RNA viruses. Mutations in this gene are associated with Encephalopathy, acute, infection-induced, herpes-specific, 7. [provided by RefSeq, Sep 2020]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...