ISG20 (NM_001303236) Human Tagged ORF Clone

CAT#: RC236242

  • TrueORF®

ISG20 (myc-DDK-tagged) - Human interferon stimulated exonuclease gene 20kDa (ISG20), transcript variant 5

ORF Plasmid: DDK tGFP



  "NM_001303236" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


ISG20 Rabbit polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

热销推荐

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms CD25; HEM45
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC236242 representing NM_001303236
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACTATCAGGTGTGAGGAGGGTCCTAGTGCAATCTCTTCTTTTCAAAGATGATACATTTGAAGCCC
AGGGAGGACTGATAATTTGCCCAAGGTCACACAGCCAGTCAAGGAGGGATTGCTCCCTTGCCAGCCCCAG
CCCCACCCAGAAGATGCTGGGTCATGTAGGGGTGGGCACATGTCTTCCTGGCCAGATCCTGCAGCTCCTG
AAAGGCAAGCTGGTGGTGGGTCATGACCTGAAGCACGACTTCCAGGCACTGAAAGAGGACATGAGCGGCT
ACACAATCTACGACACGTCCACTGACAGGCTGTTGTGGCGTGAGGCCAAGCTGGACCACTGCAGGCGTGT
CTCCCTGCGGGTGCTGAGTGAGCGCCTCCTACACAAGAGCATCCAGAACAGCCTGCTTGGACACAGCTCG
GTGGAAGATGCGAGGGCAACGATGGAGCTCTATCAAATCTCCCAGAGAATCCGAGCCCGCCGAGGGCTGC
CCCGCCTGGCTGTGTCAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC236242 representing NM_001303236
Red=Cloning site Green=Tags(s)

MKLSGVRRVLVQSLLFKDDTFEAQGGLIICPRSHSQSRRDCSLASPSPTQKMLGHVGVGTCLPGQILQLL
KGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSS
VEDARATMELYQISQRIRARRGLPRLAVSD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001303236
ORF Size 510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001303236.2
RefSeq Size 3694 bp
RefSeq ORF 513 bp
Locus ID 3669
UniProt ID Q96AZ6
MW 19.6 kDa
Gene Summary Interferon-induced antiviral exoribonuclease that acts on single-stranded RNA and also has minor activity towards single-stranded DNA. Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV) and yellow fever virus (YFV) in an exonuclease-dependent manner. May also play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...