TRAIL (TNFSF10) (NM_001190943) Human Tagged ORF Clone
CAT#: RC230918
- TrueORF®
TNFSF10 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 10 (TNFSF10), transcript variant 3
ORF Plasmid: tGFP
"NM_001190943" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | Apo-2L; APO2L; CD253; TL2; TNLG6A; TRAIL |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC230918 representing NM_001190943
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAG TGCTCCTGCAGTCTCTCTGTGTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGTTTGCAGA AAATGATTGCCAGAGACTAATGTCTGGGCAGCAGACAGGGTCATTGCTGCCATCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC230918 representing NM_001190943
Red=Cloning site Green=Tags(s) MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQFAENDCQRLMSGQQTGSLLPS myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001190943 |
ORF Size | 195 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001190943.2 |
RefSeq ORF | 198 bp |
Locus ID | 8743 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Apoptosis, Cytokine-cytokine receptor interaction, Natural killer cell mediated cytotoxicity |
MW | 7.6 kDa |
Gene Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC230918L3 | Lenti-ORF clone of TNFSF10 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 10 (TNFSF10), transcript variant 3 |
CNY 5,890.00 |
|
RC230918L4 | Lenti-ORF clone of TNFSF10 (mGFP-tagged)-Human tumor necrosis factor (ligand) superfamily, member 10 (TNFSF10), transcript variant 3 |
CNY 5,890.00 |
|
RG230918 | TNFSF10 (tGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 10 (TNFSF10), transcript variant 3 |
CNY 4,370.00 |