OSCAR (NM_130771) Human Tagged ORF Clone

CAT#: RC221675

  • TrueORF®

OSCAR (Myc-DDK-tagged)-Human osteoclast associated, immunoglobulin-like receptor (OSCAR), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_130771" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 3,600.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


OSCAR Antibody - C-terminal region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms PIgR-3; PIGR3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221675 representing NM_130771
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTGGTGCTGATCCTCCAGCTGCTGACCCTCTGGCCTCTGTGTCACACAGACATCACTCCGTCTG
TGGCCATTATAGTCCCCCCAGCTTCATACCACCCTAAGCCATGGCTGGGAGCTCAGCCGGCTACAGTTGT
GACCCCTGGGGTCAACGTGACCTTGAGATGCCGGGCACCCCAACCCGCTTGGAGATTTGGACTTTTCAAG
CCTGGAGAGATCGCTCCCCTTCTCTTCCGGGATGTGTCCTCCGAGCTGGCAGAATTCTTTCTGGAGGAGG
TGACTCCAGCCCAAGGGGGAATTTACCGCTGCTGCTACCGAAGGCCAGACTGGGGGCCGGGTGTCTGGTC
CCAGCCCAGCGATGTCCTGGAGCTGCTGGTGACAGAGGAGCTGCCGCGGCCGTCGCTGGTGGCGCTGCCC
GGGCCGGTGGTGGGTCCTGGCGCCAACGTGAGCCTGCGCTGCGCGGGCCGCCTGCGGAACATGAGCTTCG
TGCTGTACCGCGAGGGCGTGGCGGCCCCGCTGCAGTACCGCCACTCCGCGCAGCCCTGGGCCGACTTCAC
GCTGCTGGGCGCCCGCGCCCCCGGCACCTACAGCTGCTACTATCACACGCCCTCCGCGCCCTACGTGCTG
TCGCAGCGCAGCGAGGTGCTGGTCATCAGCTGGGAAGACTCTGGCTCCTCCGACTACACCCGGGGGAACC
TAGTCCGCCTGGGGCTGGCCGGGCTGGTCCTCATCTCCCTGGGCGCGCTGGTCACTTTTGACTGGCGCAG
TCAGAACCGCGCTCCTGCTGGTATCCGCCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221675 representing NM_130771
Red=Cloning site Green=Tags(s)

MALVLILQLLTLWPLCHTDITPSVAIIVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFK
PGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALP
GPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVL
SQRSEVLVISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQNRAPAGIRP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_130771
ORF Size 801 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_130771.3
RefSeq Size 1440 bp
RefSeq ORF 804 bp
Locus ID 126014
UniProt ID Q8IYS5
Protein Families Druggable Genome
MW 29 kDa
Gene Summary Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the regulation of both innate and adaptive immune responses. The encoded protein may play a role in oxidative stress-mediated atherogenesis as well as monocyte adhesion. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...