VAMP2 (NM_014232) Human Tagged ORF Clone
CAT#: RC207533
VAMP2 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 2 (synaptobrevin 2) (VAMP2)
ORF Plasmid: tGFP
"NM_014232" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | NEDHAHM; SYB2; VAMP-2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC207533 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTGCTACCGCTGCCACGGCCCCCCCTGCTGCCCCGGCTGGGGAGGGTGGTCCCCCTGCACCCCCTC CAAACCTCACCAGTAACAGGAGACTGCAGCAGACCCAGGCCCAGGTGGATGAGGTGGTGGACATCATGAG GGTGAACGTGGACAAGGTCCTGGAGCGAGACCAGAAGCTGTCGGAGCTGGACGACCGTGCAGATGCACTC CAGGCGGGGGCCTCCCAGTTTGAAACAAGCGCAGCCAAGCTCAAGCGCAAATACTGGTGGAAAAACCTCA AGATGATGATCATCTTGGGAGTGATTTGCGCCATCATCCTCATCATCATCATAGTTTACTTCAGCACT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207533 protein sequence
Red=Cloning site Green=Tags(s) MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADAL QAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_014232 |
ORF Size | 348 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_014232.3 |
RefSeq Size | 2173 bp |
RefSeq ORF | 351 bp |
Locus ID | 6844 |
UniProt ID | P63027 |
Domains | synaptobrevin |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
MW | 12.7 kDa |
Gene Summary | The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
A reference library for assigning protein subcellular localizations by image-based machine learning
,Schormann, W;Hariharan, S;Andrews, DW;,
J. Cell Biol.
,PubMed ID 31968357
[VAMP2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC207533L1 | Lenti ORF clone of Human vesicle-associated membrane protein 2 (synaptobrevin 2) (VAMP2), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC207533L2 | Lenti ORF clone of Human vesicle-associated membrane protein 2 (synaptobrevin 2) (VAMP2), mGFP tagged |
CNY 4,200.00 |
|
RC207533L3 | Lenti ORF clone of Human vesicle-associated membrane protein 2 (synaptobrevin 2) (VAMP2), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC207533L4 | Lenti ORF clone of Human vesicle-associated membrane protein 2 (synaptobrevin 2) (VAMP2), mGFP tagged |
CNY 4,200.00 |
|
RG207533 | VAMP2 (tGFP-tagged) - Human vesicle-associated membrane protein 2 (synaptobrevin 2) (VAMP2) |
CNY 3,400.00 |
|
SC115104 | VAMP2 (untagged)-Human vesicle-associated membrane protein 2 (synaptobrevin 2) (VAMP2) |
CNY 1,800.00 |