SKP1 (NM_006930) Human Tagged ORF Clone
CAT#: RC206509
SKP1 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 1 (SKP1), transcript variant 1
ORF Plasmid: tGFP
"NM_006930" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | EMC19; OCP-II; OCP2; p19A; SKP1A; TCEB1L |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC206509 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCTTCAATTAAGTTGCAGAGTTCTGATGGAGAGATATTTGAAGTTGATGTGGAAATTGCCAAACAAT CTGTGACTATTAAGACCATGTTGGAAGATTTGGGAATGGATGATGAAGGAGATGATGACCCAGTTCCTCT ACCAAATGTGAATGCAGCAATATTAAAAAAGGTCATTCAGTGGTGCACCCACCACAAGGATGACCCTCCT CCTCCTGAAGATGATGAGAACAAAGAAAAGCGAACAGATGATATCCCTGTTTGGGACCAAGAATTCCTGA AAGTTGACCAAGGAACACTTTTTGAACTCATTCTGGCTGCAAACTACTTAGACATCAAAGGTTTGCTTGA TGTTACATGCAAGACTGTTGCCAATATGATCAAGGGGAAAACTCCTGAGGAGATTCGCAAGACCTTCAAT ATCAAAAATGACTTTACTGAAGAGGAGGAAGCCCAGGTAGGTAGCACACAGTTTTGTCTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206509 protein sequence
Red=Cloning site Green=Tags(s) MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPP PPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFN IKNDFTEEEEAQVGSTQFCL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006930 |
ORF Size | 480 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006930.3 |
RefSeq Size | 2714 bp |
RefSeq ORF | 483 bp |
Locus ID | 6500 |
UniProt ID | P63208 |
Domains | Skp1 |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, TGF-beta signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathway |
MW | 18.1 kDa |
Gene Summary | This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
KDM2B Overexpression Facilitates Lytic De Novo KSHV Infection by Inducing AP-1 Activity Through Interaction with the SCF E3 Ubiquitin Ligase Complex
,Naik, NG;Lee, SC;Alonso, JD;Toth, Z;,
Journal of virology
,PubMed ID 33692209
[SKP1]
|
The F-box Protein FBXO44 Mediates BRCA1 Ubiquitination and Degradation
,Yunzhe Lu, Jiezhi Li, Dongmei Cheng, Balaji Parameswaran, Shaohua Zhang, Zefei Jiang, P. Renee Yew, Junmin Peng, Qinong Ye, and Yanfen Hu,
J. Biol. Chem., Nov 2012; 287: 41014 - 41022.
[SKP1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC206509L1 | Lenti ORF clone of Human S-phase kinase-associated protein 1 (SKP1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC206509L2 | Lenti ORF clone of Human S-phase kinase-associated protein 1 (SKP1), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC206509L3 | Lenti ORF clone of Human S-phase kinase-associated protein 1 (SKP1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC206509L4 | Lenti ORF clone of Human S-phase kinase-associated protein 1 (SKP1), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RG206509 | SKP1 (tGFP-tagged) - Human S-phase kinase-associated protein 1 (SKP1), transcript variant 1 |
CNY 2,800.00 |
|
SC126980 | SKP1 (untagged)-Human S-phase kinase-associated protein 1 (SKP1), transcript variant 1 |
CNY 1,200.00 |