CORIN Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CORIN antibody: synthetic peptide directed towards the C terminal of human CORIN. Synthetic peptide located within the following region: HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	corin, serine peptidase
Database Link	NP_006578 Entrez Gene 10699 Human UniProt ID Q9Y5Q5
Background	This gene encodes a member ofThe type II transmembrane serine protease class ofThe trypsin superfamily. Members ofThis family are composed of multiple structurally distinct domains.The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure.This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2013]
Synonyms	ATC2; CRN; Lrp4; PEE5; TMPRSS10
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Pig: 86%; Horse: 86%; Rabbit: 86%; Mouse: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Protease, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.