SULT1A1 (NM_001055) Human Mass Spec Standard
CAT#: PH301601
SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001046)
View other "SULT1A1" proteins (18)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001046) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201601 |
Predicted MW | 34.1 kDa |
Protein Sequence |
>RC201601 protein sequence
Red=Cloning site Green=Tags(s) MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC HRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY HFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF VGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY AEKMAGCSLSFRSEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001046 |
RefSeq Size | 1254 |
RefSeq ORF | 885 |
Synonyms | HAST1/HAST2; P-PST; P-PST 1; PST; ST1A1; ST1A3; STP; STP1; ts-PST; TSPST1 |
Locus ID | 6817 |
Cytogenetics | 16p11.2 |
Summary | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406098 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406099 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406103 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406105 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420735 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406098 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 2 |
CNY 3,080.00 |
|
LY406099 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 3 |
CNY 3,080.00 |
|
LY406103 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 4 |
CNY 3,080.00 |
|
LY406105 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 5 |
CNY 3,080.00 |
|
LY420735 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 |
CNY 3,080.00 |
|
PH311105 | SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803566) |
CNY 19,520.00 |
|
PH312038 | SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803565) |
CNY 19,520.00 |
|
PH312198 | SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803878) |
CNY 19,520.00 |
|
TP301601 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311105 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP312038 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP312198 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP720941 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 |
CNY 5,460.00 |
其它SULT1A1产品