SULT1A1 (NM_001055) Human Recombinant Protein
CAT#: TP301601
Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1, 20 µg
View other "SULT1A1" proteins (18)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201601 protein sequence
Red=Cloning site Green=Tags(s) MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC HRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY HFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF VGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY AEKMAGCSLSFRSEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001046 |
Locus ID | 6817 |
UniProt ID | P50225 |
Refseq Size | 1254 |
Cytogenetics | 16p11.2 |
Refseq ORF | 885 |
Synonyms | HAST1/HAST2; P-PST; P-PST 1; PST; ST1A1; ST1A3; STP; STP1; ts-PST; TSPST1 |
Summary | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406098 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406099 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406103 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406105 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420735 | SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406098 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 2 |
CNY 3,080.00 |
|
LY406099 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 3 |
CNY 3,080.00 |
|
LY406103 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 4 |
CNY 3,080.00 |
|
LY406105 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 5 |
CNY 3,080.00 |
|
LY420735 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 |
CNY 3,080.00 |
|
PH301601 | SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001046) |
CNY 19,520.00 |
|
PH311105 | SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803566) |
CNY 19,520.00 |
|
PH312038 | SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803565) |
CNY 19,520.00 |
|
PH312198 | SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803878) |
CNY 19,520.00 |
|
TP311105 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP312038 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP312198 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP720941 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 |
CNY 5,460.00 |
其它SULT1A1产品