Jaml (NM_001005421) Mouse Recombinant Protein
CAT#: TP505923
Purified recombinant protein of Mouse junction adhesion molecule like (Jaml), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205923 protein sequence
Red=Cloning site Green=Tags(s) MLCLLKLIVIPVILAPVGYPQGLPGLTVSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDAS EYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLP EEPKDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDL TGDISRNDGSIKLQTVKESDRGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGNQ LVIIVGIVCATFLLLPVLILIVKKAKWNKSSVSSMASVKSLENKEKINPEKHIYSSITTWETTERGISGE SEGTYMTMNPVWPSSPKASSLVRSSVRSK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 42.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001005421 |
Locus ID | 270152 |
UniProt ID | Q80UL9 |
Refseq Size | 2472 |
Cytogenetics | 9 A5.2 |
Refseq ORF | 1140 |
Synonyms | AMICA; Amica1; Crea7; Gm638 |
Summary | Transmembrane protein of the plasma membrane of leukocytes that control their migration and activation through interaction with CXADR, a plasma membrane receptor found on adjacent epithelial and endothelial cells. The interaction between both receptors mediates the activation of gamma-delta T-cells, a subpopulation of T-cells residing in epithelia and involved in tissue homeostasis and repair. Upon epithelial CXADR-binding, JAML induces downstream cell signaling events in gamma-delta T-cells through PI3-kinase and MAP kinases. It results in proliferation and production of cytokines and growth factors by T-cells that in turn stimulate epithelial tissues repair. It also controls the transmigration of leukocytes within epithelial and endothelial tissues through adhesive interactions with epithelial and endothelial CXADR.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |