United States
Germany
Japan
United Kingdom
China
ZADH1 (PTGR2) (NM_001146154) Human Recombinant Protein
CAT＃: TP328838
Recombinant protein of human prostaglandin reductase 2 (PTGR2), transcript variant 2, 20 µg
View other "ZADH1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228838 protein sequence
Red=Cloning site Green=Tags(s) MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQL SQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTS LIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKK DNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKER NITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEIS L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001139626 |
| Locus ID | 145482 |
| UniProt ID | Q8N8N7, V9HW32 |
| Refseq Size | 2520 |
| Cytogenetics | 14q24.3 |
| Refseq ORF | 1053 |
| Synonyms | HEL-S-298; PGR2; ZADH1 |
| Summary | This gene encodes an enzyme involved in the metabolism of prostaglandins. The encoded protein catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. This protein may also be involved in regulating activation of the peroxisome proliferator-activated receptor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403472 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431866 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431867 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403472 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 1 |
CNY 3,080.00 |
|
| LY431866 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 2 |
CNY 3,080.00 |
|
| LY431867 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 3 |
CNY 3,080.00 |
|
| PH309182 | PTGR2 MS Standard C13 and N15-labeled recombinant protein (NP_689657) |
CNY 19,520.00 |
|
| TP309182 | Recombinant protein of human prostaglandin reductase 2 (PTGR2), 20 µg |
CNY 2,900.00 |
|
| TP328839 | Recombinant protein of human prostaglandin reductase 2 (PTGR2), transcript variant 3, 20 µg |
CNY 2,900.00 |
