Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Recombinant Protein
CAT#: TP325494
Purified recombinant protein of Homo sapiens activin A receptor, type IC (ACVR1C), transcript variant 4, 20 µg
View other "Activin A Receptor Type IC" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225494 representing NM_001111033
Red=Cloning site Green=Tags(s) MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELN AQVFCHSSNNVTKTECCFTDFCNNITLHLPTDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLAL SIASGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQNPKVGTKR YMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYDMVPSDPSIEEMRKVVCD QKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKKTISQLCVKEDCKA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001104503 |
Locus ID | 130399 |
UniProt ID | Q8NER5 |
Cytogenetics | 2q24.1 |
Refseq ORF | 1008 |
Synonyms | ACVRLK7; ALK7 |
Summary | ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Adherens junction, Chronic myeloid leukemia, Colorectal cancer, Endocytosis, MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403426 | ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426337 | ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426339 | ACVR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403426 | Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 1 |
CNY 3,080.00 |
|
LY426337 | Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 2 |
CNY 3,080.00 |
|
LY426339 | Transient overexpression lysate of activin A receptor, type IC (ACVR1C), transcript variant 4 |
CNY 3,080.00 |
|
PH325494 | ACVR1C MS Standard C13 and N15-labeled recombinant protein (NP_001104503) |
CNY 14,250.00 |
|
TP761292 | Purified recombinant protein of Human activin A receptor, type IC (ACVR1C), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Activin A Receptor Type IC产品