TAGAP (NM_152133) Human Recombinant Protein
CAT#: TP323030
Recombinant protein of human T-cell activation RhoGTPase activating protein (TAGAP), transcript variant 1, 20 µg
View other "TAGAP" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223030 representing NM_152133
Red=Cloning site Green=Tags(s) MGALEMQDEEDRIEALKQVADKLPRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLENDQ SLSFEAQKDLNNKVKTLVEFLIDNCFEIFGENIPVHSSITSDDSLEHTDSSDVSTLQNDSAYDSNDPDVE SNSSSGISSPSRQPQVPMATAAGLDSAGPQDAREVSPEPIVSTVARLKSSLAQPDRRYSEPSMPSSQECL ESRVTNQTLTKSEGDFPVPRVGSRLESEEAEDPFPEEVFPAVQGKTKRPVDLKIKNLAPGSVLPRALVLK AFSSSSLDASSDSSPVASPSSPKRNFFSRHQSFTTKTEKGKPSREIKKHSMSFTFAPHKKVLTKNLSAGS GKSQDFTRDHVPRGVRKESQLAGRIVQENGCETHNQTARGFCLRPHALSVDDVFQGADWERPGSPPSYEE AMQGPAARLVASESQTVGSMTVGSMRARMLEAHCLLPPLPPAHHVEDSRHRGSKEPLPGHGLSPLPERWK QSRTVHASGDSLGHVSGPGRPELLPLRTVSESVQRNKRDCLVRRCSQPVFEADQFQYAKESYI SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 60.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_687034 |
Locus ID | 117289 |
UniProt ID | Q8N103, Q8N103-2 |
Refseq Size | 3196 |
Cytogenetics | 6q25.3 |
Refseq ORF | 1659 |
Synonyms | ARHGAP47; FKSG15; IDDM21; TAGAP1 |
Summary | This gene encodes a member of the Rho GTPase-activator protein superfamily. The encoded protein may function as a Rho GTPase-activating protein. Alterations in this gene may be associated with several diseases, including rheumatoid arthritis, celiac disease, and multiple sclerosis. Alternate splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407719 | TAGAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC408495 | TAGAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407719 | Transient overexpression lysate of T-cell activation RhoGTPase activating protein (TAGAP), transcript variant 1 |
CNY 4,840.00 |
|
LY408495 | Transient overexpression lysate of T-cell activation RhoGTPase activating protein (TAGAP), transcript variant 3 |
CNY 3,080.00 |
|
PH323030 | TAGAP MS Standard C13 and N15-labeled recombinant protein (NP_687034) |
CNY 14,250.00 |