JAML (NM_001098526) Human Recombinant Protein
CAT#: TP318818
Recombinant protein of human adhesion molecule, interacts with CXADR antigen 1 (AMICA1), transcript variant 1, 20 µg
View other "JAML" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218818 representing NM_001098526
Red=Cloning site Green=Tags(s) MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLSPGEHAKDEYV LYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRLKGESQVFKKAVVLHVLPEEP KELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEEIVFRYYHKLRMSVEYSQSWGHFQNRVNLVG DIFRNDGSIMLQGVRESDGGNYTCSIHLGNLVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVG IVCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEE EEPSEKSEATYMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001091996 |
Locus ID | 120425 |
UniProt ID | Q86YT9, B3KUI3 |
Refseq Size | 1957 |
Cytogenetics | 11q23.3 |
Refseq ORF | 1182 |
Synonyms | AMICA; AMICA1; CREA7-1; CREA7-4; Gm638 |
Summary | Transmembrane protein of the plasma membrane of leukocytes that control their migration and activation through interaction with CXADR, a plasma membrane receptor found on adjacent epithelial and endothelial cells. The interaction between both receptors mediates the activation of gamma-delta T-cells, a subpopulation of T-cells residing in epithelia and involved in tissue homeostasis and repair. Upon epithelial CXADR-binding, JAML induces downstream cell signaling events in gamma-delta T-cells through PI3-kinase and MAP kinases. It results in proliferation and production of cytokines and growth factors by T-cells that in turn stimulate epithelial tissues repair. It also controls the transmigration of leukocytes within epithelial and endothelial tissues through adhesive interactions with epithelial and endothelial CXADR.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407136 | AMICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420624 | AMICA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407136 | Transient overexpression lysate of adhesion molecule, interacts with CXADR antigen 1 (AMICA1), transcript variant 2 |
CNY 3,080.00 |
|
LY420624 | Transient overexpression lysate of adhesion molecule, interacts with CXADR antigen 1 (AMICA1), transcript variant 1 |
CNY 3,080.00 |
|
PH318818 | AMICA1 MS Standard C13 and N15-labeled recombinant protein (NP_001091996) |
CNY 14,250.00 |