DUSP15 (NM_177991) Human Recombinant Protein
CAT#: TP316271
Recombinant protein of human dual specificity phosphatase 15 (DUSP15), transcript variant 2, 20 µg
View other "DUSP15" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216271 representing NM_177991
Red=Cloning site Green=Tags(s) MTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKLRRQLEERFGESPFRDEEELRALLPLCK RCRQGSATSASSAGPHSAASEGTVQRLVPRTPREAHRPLPLLARVKQTFSCLPRCLSRKGGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_817130 |
Locus ID | 128853 |
UniProt ID | Q9H1R2 |
Refseq Size | 1184 |
Cytogenetics | 20q11.21 |
Refseq ORF | 396 |
Synonyms | C20orf57; VHY |
Summary | The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405882 | DUSP15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409154 | DUSP15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405882 | Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 2 |
CNY 3,080.00 |
|
LY409154 | Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 1 |
CNY 3,080.00 |
|
PH316271 | DUSP15 MS Standard C13 and N15-labeled recombinant protein (NP_817130) |
CNY 14,250.00 |