NCALD (NM_001040625) Human Recombinant Protein
CAT#: TP313925
Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 2, 20 µg
View other "NCALD" proteins (32)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213925 protein sequence
Red=Cloning site Green=Tags(s) MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE DESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035715 |
Locus ID | 83988 |
UniProt ID | P61601, B2RB70 |
Refseq Size | 3673 |
Cytogenetics | 8q22.3 |
Refseq ORF | 579 |
Summary | This gene encodes a member of the neuronal calcium sensor (NCS) family of calcium-binding proteins. The protein contains an N-terminal myristoylation signal and four EF-hand calcium binding loops. The protein is cytosolic at resting calcium levels; however, elevated intracellular calcium levels induce a conformational change that exposes the myristoyl group, resulting in protein association with membranes and partial co-localization with the perinuclear trans-golgi network. The protein is thought to be a regulator of G protein-coupled receptor signal transduction. Several alternatively spliced variants of this gene have been determined, all of which encode the same protein; additional variants may exist but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410350 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421783 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421784 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421785 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421786 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421787 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421788 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421789 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410350 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 8 |
CNY 3,080.00 |
|
LY421783 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 1 |
CNY 3,080.00 |
|
LY421784 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 2 |
CNY 3,080.00 |
|
LY421785 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 3 |
CNY 3,080.00 |
|
LY421786 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 4 |
CNY 3,080.00 |
|
LY421787 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 5 |
CNY 3,080.00 |
|
LY421788 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 6 |
CNY 3,080.00 |
|
LY421789 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 7 |
CNY 3,080.00 |
|
PH306321 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035720) |
CNY 14,250.00 |
|
PH312908 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035718) |
CNY 14,250.00 |
|
PH313925 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035715) |
CNY 14,250.00 |
|
PH314160 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035716) |
CNY 14,250.00 |
|
PH314659 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_114430) |
CNY 19,520.00 |
|
PH318434 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035719) |
CNY 14,250.00 |
|
PH320693 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035717) |
CNY 14,250.00 |
|
PH321428 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035714) |
CNY 14,250.00 |
|
TP306321 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
TP312908 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP314160 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP314659 | Recombinant protein of human neurocalcin delta (NCALD), transcript variant 8, 20 µg |
CNY 2,900.00 |
|
TP318434 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
TP320693 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP321428 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720212 | Recombinant protein of human neurocalcin delta (NCALD), transcript variant 1 |
CNY 5,460.00 |