VCAM1 (NM_080682) Human Recombinant Protein
CAT#: TP313353
Recombinant protein of human vascular cell adhesion molecule 1 (VCAM1), transcript variant 2, 20 µg
View other "VCAM1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213353 representing NM_080682
Red=Cloning site Green=Tags(s) MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGK VTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVA DVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTV RQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIA MRMEDSGIYVCEGVNLIGKNRKEVELIVQAFPRDPEIEMSGGLVNGSSVTVSCKVPSVYPLDRLEIELLK GETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPR DTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGI NQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGA YTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFARK ANMKGSYSLVEAQKSKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 68.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542413 |
Locus ID | 7412 |
UniProt ID | P19320 |
Refseq Size | 2944 |
Cytogenetics | 1p21.2 |
Refseq ORF | 1941 |
Synonyms | CD106; INCAM-100 |
Summary | This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421491 | VCAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421491 | Transient overexpression lysate of vascular cell adhesion molecule 1 (VCAM1), transcript variant 1 |
CNY 3,080.00 |
|
PH309761 | VCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001069) |
CNY 19,520.00 |
|
PH313353 | VCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_542413) |
CNY 14,250.00 |
|
TP309761 | Recombinant protein of human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720627 | Purified recombinant protein of Human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1 |
CNY 3,710.00 |