Carboxypeptidase H (CPE) (NM_001873) Human Recombinant Protein
CAT#: TP308791
Recombinant protein of human carboxypeptidase E (CPE), 20 µg
View other "Carboxypeptidase H" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208791 representing NM_001873
Red=Cloning site Green=Tags(s) MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQC TAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNE TIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNH LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQS LARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPP EETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001864 |
Locus ID | 1363 |
UniProt ID | P16870, A0A384N679 |
Refseq Size | 2443 |
Cytogenetics | 4q32.3 |
Refseq ORF | 1428 |
Synonyms | CPH; IDDHH |
Summary | This gene encodes a member of the M14 family of metallocarboxypeptidases. The encoded preproprotein is proteolytically processed to generate the mature peptidase. This peripheral membrane protein cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. This protein may also function independently of its peptidase activity, as a neurotrophic factor that promotes neuronal survival, and as a sorting receptor that binds to regulated secretory pathway proteins, including prohormones. Mutations in this gene are implicated in type 2 diabetes. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419701 | CPE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419701 | Transient overexpression lysate of carboxypeptidase E (CPE) |
CNY 3,080.00 |
|
PH308791 | CPE MS Standard C13 and N15-labeled recombinant protein (NP_001864) |
CNY 14,250.00 |
|
TP721092 | Purified recombinant protein of Human carboxypeptidase E (CPE) |
CNY 5,460.00 |
其它Carboxypeptidase H产品