TGF beta 1 (TGFB1) (NM_000660) Human Recombinant Protein
CAT#: TP300973
Recombinant protein of human transforming growth factor, beta 1 (TGFB1), 20 µg
View other "TGF beta 1" proteins (2)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 4 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC200973
Blue=ORF Red=Cloning site Green=Tag(s) MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVP PGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTS ELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQW LSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRH RRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQ HNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS myc-FLAG tag Recombinant protein using RC200973 also available, TP300973M |
Tag | C-Myc/DDK |
Predicted MW | 28.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Ex vivo tissue treatment (PMID: 25595579) |
Reference Data | |
RefSeq | NP_000651 |
Locus ID | 7040 |
UniProt ID | P01137, A0A499FJK2 |
Refseq Size | 2583 |
Cytogenetics | 19q13.2 |
Refseq ORF | 1170 |
Synonyms | CED; DPD1; IBDIMDE; LAP; TGF-beta1; TGFB; TGFbeta |
Summary | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transcription Factors |
Protein Pathways | Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
Fortilin interacts with TGF-β1 and prevents TGF-β receptor activation
,null,
Communications Biology
,PubMed ID 35197550
[TGFB1]
|
A Novel Bioreactor System Capable of Simulating the In Vivo Conditions of Synovial Joints
,Tekari, A;Egli, RJ;Schmid, V;Justiz, J;Luginbuehl, R;,
Tissue engineering. Part C, Methods
,PubMed ID 33267725
[TGFB1]
|
Molecular mechanisms involved in TGF-β1-induced Muscle-derived stem cells differentiation to smooth muscle cells
,Tang, X;Su, X;Zhong, Z;Wen, C;Zhang, T;Zhu, Y;,
Am J Transl Res
,PubMed ID 31497230
[TGFB1]
|
Oxidative stress is responsible for maternal diabetes-impaired transforming growth factor beta signaling in the developing mouse heart
,Wang, F;Reece, EA;Yang, P;,
Am. J. Obstet. Gynecol.
,PubMed ID 25595579
[TGFB1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
其它TGF beta 1产品