Sonic Hedgehog (SHH) (NM_000193) Human Mass Spec Standard
CAT#: PH322175
SHH MS Standard C13 and N15-labeled recombinant protein (NP_000184)
View other "Sonic Hedgehog" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SHH MS Standard C13 and N15-labeled recombinant protein (NP_000184) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222175 |
Predicted MW | 49.6 kDa |
Protein Sequence |
>RC222175 representing NM_000193
Red=Cloning site Green=Tags(s) MGEMLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKIS RNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEE SLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHL EQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPH NDSATGEPEASSGSGPPSGGALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAP LTAQGTILINRVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTA PGAADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000184 |
RefSeq Size | 1577 |
RefSeq ORF | 1386 |
Synonyms | HHG1; HLP3; HPE3; MCOPCB5; ShhNC; SMMCI; TPT; TPTPS |
Locus ID | 6469 |
Cytogenetics | 7q36.3 |
Summary | This gene encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. It is also thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities. Additionally, mutations in a long range enhancer located approximately 1 megabase upstream of this gene disrupt limb patterning and can result in preaxial polydactyly. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | Basal cell carcinoma, Hedgehog signaling pathway, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424868 | SHH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY424868 | Transient overexpression lysate of sonic hedgehog homolog (Drosophila) (SHH) |
CNY 4,840.00 |
|
TP322175 | Recombinant protein of human sonic hedgehog homolog (Drosophila) (SHH), 20 µg |
CNY 2,900.00 |
|
TP720599 | Purified recombinant protein of Human sonic hedgehog (SHH) |
CNY 4,550.00 |
|
TP720610 | Purified recombinant protein of Human sonic hedgehog (SHH) |
CNY 4,800.00 |
其它Sonic Hedgehog产品