CCT3 (NM_005998) Human Mass Spec Standard
CAT#: PH321229
CCT3 MS Standard C13 and N15-labeled recombinant protein (NP_005989)
View other "CCT3" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CCT3 MS Standard C13 and N15-labeled recombinant protein (NP_005989) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221229 |
Predicted MW | 60.4 kDa |
Protein Sequence |
>RC221229 representing NM_005998
Red=Cloning site Green=Tags(s) MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREI QVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKI SIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIE DSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCE DIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLL EIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDM KELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005989 |
RefSeq Size | 2096 |
RefSeq ORF | 1635 |
Synonyms | CCT-gamma; CCTG; PIG48; TCP-1-gamma; TRIC5 |
Locus ID | 7203 |
Cytogenetics | 1q22 |
Summary | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8. [provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416943 | CCT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423380 | CCT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416943 | Transient overexpression lysate of chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 1 |
CNY 3,080.00 |
|
LY423380 | Transient overexpression lysate of chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 3 |
CNY 4,840.00 |
|
TP303580 | Recombinant protein of human chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP321229 | Recombinant protein of human chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 1, 20 µg |
CNY 2,900.00 |