United States
Germany
Japan
United Kingdom
China
BIN1 (NM_139344) Human Mass Spec Standard
CAT＃: PH320585
BIN1 MS Standard C13 and N15-labeled recombinant protein (NP_647594)
View other "BIN1" proteins (21)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | BIN1 MS Standard C13 and N15-labeled recombinant protein (NP_647594) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220585 |
| Predicted MW | 59.8 kDa |
| Protein Sequence |
>RC220585 representing NM_139344
Red=Cloning site Green=Tags(s) MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLA SVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRI AKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELI KAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFT VKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQFEAPGPFSEQASLLDL DFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASE VAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTA TDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_647594 |
| RefSeq Size | 2508 |
| RefSeq ORF | 1650 |
| Synonyms | AMPH2; AMPHL; CNM2; SH3P9 |
| Locus ID | 274 |
| Cytogenetics | 2q14.3 |
| Summary | This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in several transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. [provided by RefSeq, Mar 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403388 | BIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408302 | BIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408303 | BIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408305 | BIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408306 | BIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408307 | BIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408308 | BIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC418073 | BIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY403388 | Transient overexpression lysate of bridging integrator 1 (BIN1), transcript variant 9 |
CNY 3,080.00 |
|
| LY408302 | Transient overexpression lysate of bridging integrator 1 (BIN1), transcript variant 1 |
CNY 4,840.00 |
|
| LY408303 | Transient overexpression lysate of bridging integrator 1 (BIN1), transcript variant 2 |
CNY 4,840.00 |
|
| LY408305 | Transient overexpression lysate of bridging integrator 1 (BIN1), transcript variant 4 |
CNY 4,840.00 |
|
| LY408306 | Transient overexpression lysate of bridging integrator 1 (BIN1), transcript variant 5 |
CNY 4,840.00 |
|
| LY408307 | Transient overexpression lysate of bridging integrator 1 (BIN1), transcript variant 6 |
CNY 4,840.00 |
|
| LY408308 | Transient overexpression lysate of bridging integrator 1 (BIN1), transcript variant 7 |
CNY 4,840.00 |
|
| LY418073 | Transient overexpression lysate of bridging integrator 1 (BIN1), transcript variant 8 |
CNY 4,840.00 |
|
| PH302423 | BIN1 MS Standard C13 and N15-labeled recombinant protein (NP_647600) |
CNY 19,520.00 |
|
| PH320616 | BIN1 MS Standard C13 and N15-labeled recombinant protein (NP_004296) |
CNY 14,250.00 |
|
| TP302423 | Recombinant protein of human bridging integrator 1 (BIN1), transcript variant 9, 20 µg |
CNY 2,900.00 |
|
| TP320585 | Recombinant protein of human bridging integrator 1 (BIN1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP320616 | Recombinant protein of human bridging integrator 1 (BIN1), transcript variant 8, 20 µg |
CNY 2,900.00 |
