United States
Germany
Japan
United Kingdom
China
HFE (NM_000410) Human Mass Spec Standard
CAT＃: PH317447
HFE MS Standard C13 and N15-labeled recombinant protein (NP_000401)
View other "HFE" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | HFE MS Standard C13 and N15-labeled recombinant protein (NP_000401) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217447 |
| Predicted MW | 40.11 kDa |
| Protein Sequence |
>RC217447 representing NM_000410
Red=Cloning site Green=Tags(s) MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLV KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000401 |
| RefSeq Size | 2727 |
| RefSeq ORF | 1044 |
| Synonyms | HFE1; HH; HLA-H; MVCD7; TFQTL2 |
| Locus ID | 3077 |
| Cytogenetics | 6p22.2 |
| Summary | The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408433 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408436 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424725 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408433 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 6 |
CNY 3,080.00 |
|
| LY408436 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 9 |
CNY 3,080.00 |
|
| LY424725 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 1 |
CNY 3,080.00 |
|
| PH319316 | HFE MS Standard C13 and N15-labeled recombinant protein (NP_620575) |
CNY 14,250.00 |
|
| PH319465 | HFE MS Standard C13 and N15-labeled recombinant protein (NP_620578) |
CNY 14,250.00 |
|
| TP317447 | Recombinant protein of human hemochromatosis (HFE), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP319316 | Purified recombinant protein of Homo sapiens hemochromatosis (HFE), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
| TP319465 | Purified recombinant protein of Homo sapiens hemochromatosis (HFE), transcript variant 9, 20 µg |
CNY 2,900.00 |
