M-CSF (CSF1) (NM_172211) Human Mass Spec Standard
CAT#: PH317172
CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350)
View other "M-CSF" proteins (19)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217172 |
Predicted MW | 29 kDa |
Protein Sequence |
>RC217172 representing NM_172211
Red=Cloning site Green=Tags(s) MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGSSSPQLQESVFHLLVPSVILV LLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_757350 |
RefSeq Size | 1855 |
RefSeq ORF | 768 |
Synonyms | CSF-1; MCSF |
Locus ID | 1435 |
Cytogenetics | 1p13.3 |
Summary | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406741 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406742 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430359 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 |
CNY 4,840.00 |
|
LY406741 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 |
CNY 3,080.00 |
|
LY406742 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3,080.00 |
|
LY424534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
CNY 3,080.00 |
|
LY430359 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3,080.00 |
|
PH305855 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757351) |
CNY 19,520.00 |
|
PH313103 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757349) |
CNY 19,520.00 |
|
PH317104 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748) |
CNY 19,520.00 |
|
TP305855 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP313103 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP317104 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317172 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720352 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
CNY 5,460.00 |
|
TP723739 | Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
CNY 3,560.00 |