United States
Germany
Japan
United Kingdom
China
Asialoglycoprotein Receptor 2 (ASGR2) (NM_001181) Human Mass Spec Standard
CAT＃: PH313607
ASGR2 MS Standard C13 and N15-labeled recombinant protein (NP_001172)
View other "Asialoglycoprotein Receptor 2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | ASGR2 MS Standard C13 and N15-labeled recombinant protein (NP_001172) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213607 |
| Predicted MW | 35 kDa |
| Protein Sequence |
>RC213607 representing NM_001181
Red=Cloning site Green=Tags(s) MAKDFQDIQQLSSEENDHPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPLAQRLCSMVCFSLLALSFNILL LVVICVTGSQSEGHRGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLK ADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENA HLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVE VQPDGRWNDDFCLQVYRWVCEKRRNATGEVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001172 |
| RefSeq Size | 1405 |
| RefSeq ORF | 933 |
| Synonyms | ASGP-R2; ASGPR2; CLEC4H2; HBXBP; HL-2 |
| Locus ID | 433 |
| Cytogenetics | 17p13.1 |
| Summary | This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408999 | ASGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409000 | ASGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409001 | ASGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420082 | ASGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408999 | Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant H2' |
CNY 3,080.00 |
|
| LY409000 | Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant 2 |
CNY 3,080.00 |
|
| LY409001 | Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant 3 |
CNY 3,080.00 |
|
| LY420082 | Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant 1 |
CNY 3,080.00 |
|
| PH317541 | ASGR2 MS Standard C13 and N15-labeled recombinant protein (NP_550436) |
CNY 19,520.00 |
|
| TP313607 | Purified recombinant protein of Homo sapiens asialoglycoprotein receptor 2 (ASGR2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP317541 | Recombinant protein of human asialoglycoprotein receptor 2 (ASGR2), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Asialoglycoprotein Receptor 2产品
