Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Mass Spec Standard
CAT#: PH310245
CCL18 MS Standard C13 and N15-labeled recombinant protein (NP_002979)
View other "Macrophage Inflammatory Protein 4" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | CCL18 MS Standard C13 and N15-labeled recombinant protein (NP_002979) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210245 |
Predicted MW | 9.8 kDa |
Protein Sequence |
>RC210245 protein sequence
Red=Cloning site Green=Tags(s) MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC ADPNKKWVQKYISDLKLNA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002979 |
RefSeq Size | 798 |
RefSeq ORF | 267 |
Synonyms | AMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18 |
Locus ID | 6362 |
Cytogenetics | 17q12 |
Summary | This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Antibody to FcεRIα Suppresses Immunoglobulin E Binding to High-Affinity Receptor I in Allergic Inflammation
,null,
Yonsei Medical Journal
,PubMed ID 27593869
[CCL18]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418972 | CCL18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418972 | Transient overexpression lysate of chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18) |
CNY 3,080.00 |
|
TP310245 | Recombinant protein of human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), 20 µg |
CNY 2,900.00 |
|
TP720895 | Purified recombinant protein of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18) |
CNY 5,460.00 |
其它Macrophage Inflammatory Protein 4产品