Cathepsin L (CTSL) (NM_001912) Human Mass Spec Standard
CAT#: PH303143
CTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_001903)
View other "Cathepsin L" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_001903) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203143 |
Predicted MW | 37.5 kDa |
Protein Sequence |
>RC203143 protein sequence
Red=Cloning site Green=Tags(s) MNPTLILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGK HSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWA FSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEES CKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLV VGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001903 |
RefSeq Size | 1730 |
RefSeq ORF | 999 |
Synonyms | CATL; CTSL1; MEP |
Locus ID | 1514 |
Cytogenetics | 9q21.33 |
Summary | The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. Additionally, this protein cleaves the S1 subunit of the SARS-CoV-2 spike protein, which is necessary for entry of the virus into the cell. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Antigen processing and presentation, Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400711 | CTSL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407805 | CTSL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400711 | Transient overexpression lysate of cathepsin L1 (CTSL1), transcript variant 1 |
CNY 3,080.00 |
|
LY407805 | Transient overexpression lysate of cathepsin L1 (CTSL1), transcript variant 2 |
CNY 3,080.00 |
|
PH323541 | CTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_666023) |
CNY 19,520.00 |
|
TP303143 | Recombinant protein of human cathepsin L1 (CTSL1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP323541 | Recombinant protein of human cathepsin L1 (CTSL1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720657 | Purified recombinant protein of Human cathepsin L1 (CTSL1), transcript variant 1 |
CNY 5,460.00 |
其它Cathepsin L产品