United States
Germany
Japan
United Kingdom
China
GATA3 (NM_002051) Human Mass Spec Standard
CAT＃: PH301618
GATA3 MS Standard C13 and N15-labeled recombinant protein (NP_002042)
View other "GATA3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | GATA3 MS Standard C13 and N15-labeled recombinant protein (NP_002042) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201618 |
| Predicted MW | 48 kDa |
| Protein Sequence |
>RC201618 protein sequence
Red=Cloning site Green=Tags(s) MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP TPMHPPSSLSFGPHHPSSMVTAMG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002042 |
| RefSeq Size | 3067 |
| RefSeq ORF | 1332 |
| Synonyms | HDR; HDRS |
| Locus ID | 2625 |
| Cytogenetics | 10p14 |
| Summary | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009] |
| Protein Families | Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400759 | GATA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424146 | GATA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400759 | Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 2 |
CNY 3,080.00 |
|
| LY424146 | Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 1 |
CNY 4,840.00 |
|
| TP301618 | Recombinant protein of human GATA binding protein 3 (GATA3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP761574 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
|
| TP762348 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Pro189-Ser201(8 reapeat regions linked with GGGGS), with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
|
| TP762449 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Met1-Thr156, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
