Placental lactogen (CSH1) (NM_022640) Human Tagged ORF Clone

CAT#: RC223244

CSH1 (Myc-DDK-tagged)-Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_022640" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,990.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms CSA; CSH2; CSMT; FLJ75407; PL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223244 representing NM_022640
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCAGGCTCCCGGACGTCCCTGCTCCTGGCTTTTGCCCTGCTCTGCCTGCCCTGGCTTCAAGAGG
CTGGTGCCGTCCAAACCGTTCCGTTATCCAGGCTTTTTGACCACGCTATGCTCCAAGCCCATCGCGCGCA
CCAGCTGGCCATTGACACCTACCAGGAGTTTGAAGAAACCTATATCCCAAAGGACCAGAAGTATTCATTC
CTGCATGACTCCCAGACCTCCTTCTGCTTCTCAGACTCTATTCCGACACCCTCCAACATGGAGGAAACGC
AACAGAAATCCAATCTAGAGCTGCTCCGCATCTCCCTGCTGCTCATCGAGTCGTGGCTGGAGCCCGTGCG
GTTCCTCAGGAGTATGTTCGCCAACAACCTGGTGTATGACACCTCGGACAGCGATGACTATCACCTCCTA
AAGGACCTAGAGGAAGGCATCCAAACGCTGATGGGGGTGAGGGTGGCGCCAGGGGTCACCAATCCTGGAA
CCCCACTGGCTTCGAGGGCTGGGGGAGAGAAATACTGCTGCCCTCTTTTTAGCAGTAAGGCGCTGACCCA
AGAGAACTCACCTTATTCTTCATTTCGCCTGGTGAATCCTCCAGGCCTTTCTCTACACCCTGAAGGGGAG
GGAGGAAAATGGATAAATGAGAGAGGGAGGGAACAGTGCCCAAGCGCTTGGCCTCTCCTTCTCTTCCTTC
ACTTTGCAGAGGCTGGAAGACGGCAGCCGCCGGACTGGGCAGATCCTCAAGCAGACCTACAGCAAGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223244 representing NM_022640
Red=Cloning site Green=Tags(s)

MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF
LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL
KDLEEGIQTLMGVRVAPGVTNPGTPLASRAGGEKYCCPLFSSKALTQENSPYSSFRLVNPPGLSLHPEGE
GGKWINERGREQCPSAWPLLLFLHFAEAGRRQPPDWADPQADLQQV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022640
ORF Size 768 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022640.3
RefSeq Size 1132 bp
RefSeq ORF 770 bp
Locus ID 1442
Protein Families Druggable Genome
Protein Pathways Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction
MW 28.6 kDa
Gene Summary The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...