SAP155 (SF3B1) (NM_001005526) Human Tagged ORF Clone
CAT#: RC219649
SF3B1 (Myc-DDK-tagged)-Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2
ORF Plasmid: tGFP
"NM_001005526" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 4,180.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | Hsh155; MDS; PRP10; PRPF10; SAP155; SF3b155 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC219649 representing NM_001005526
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGAAGATCGCCAAGACTCACGAAGATATTGAAGCACAGATTCGAGAAATTCAAGGCAAGAAGGCAG CTCTTGATGAAGCTCAAGGAGTGGGCCTCGATTCTACAGGTTATTATGACCAGGAAATTTATGGTGGAAG TGACAGCAGATTTGCTGGATACGTGACATCAATTGCTGCAACTGAACTTGAAGATGATGACGATGACTAT TCATCATCTACGAGTTTGCTTGGTCAGAAGAAGCCAGGATATCATGCCCCTGTGGCATTGCTTAATGATA TACCACAGTCAACAGAACAGTATGATCCATTTGCTGAGCACAGACCTCCAAAGATTGCAGACCGGGAAGA TGAATACAAAAAGCATAGGCGGACCATGATAATTTCCCCAGAGCGTCTTGATCCTTTTGCAGATGGCTTC TATTCTGCTGCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC219649 representing NM_001005526
Red=Cloning site Green=Tags(s) MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDY SSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGF YSAA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001005526 |
ORF Size | 432 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001005526.2, NP_001005526.1 |
RefSeq Size | 647 bp |
RefSeq ORF | 435 bp |
Locus ID | 23451 |
Protein Pathways | Spliceosome |
MW | 15.8 kDa |
Gene Summary | This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Jerantinine A induces tumor-specific cell death through modulation of splicing factor 3b subunit 1 (SF3B1)
,Chung, FF;Tan, PF;Raja, VJ;Tan, BS;Lim, KH;Kam, TS;Hii, LW;Tan, SH;See, SJ;Tan, YF;Wong, LZ;Yam, WK;Mai, CW;Bradshaw, TD;Leong, CO;,
Sci Rep
,PubMed ID 28198434
[SAP155]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC219649L1 | Lenti ORF clone of Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, Myc-DDK-tagged |
CNY 4,200.00 |
|
RC219649L2 | Lenti ORF clone of Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, mGFP tagged |
CNY 4,200.00 |
|
RC219649L3 | Lenti ORF clone of Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC219649L4 | Lenti ORF clone of Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, mGFP tagged |
CNY 4,200.00 |
|
RG219649 | SF3B1 (tGFP-tagged) - Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2 |
CNY 3,400.00 |
|
SC300999 | SF3B1 (untagged)-Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2 |
CNY 1,800.00 |