SCDGFB (PDGFD) Rabbit Polyclonal Antibody
CAT#: TA344192
Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | platelet derived growth factor D |
Database Link | |
Background | The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f |
Synonyms | IEGF; MSTP036; SCDGF-B; SCDGFB |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rabbit: 93%; Mouse: 86% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Focal adhesion, Gap junction, Melanoma, Prostate cancer, Regulation of actin cytoskeleton |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |