Exportin 5 (XPO5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the middle region of human XPO5. Synthetic peptide located within the following region: MEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	136 kDa
Gene Name	exportin 5
Database Link	NP_065801 Entrez Gene 57510 Human UniProt ID Q9HAV4
Background	This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process. [provided by RefSeq, Aug 2011]
Synonyms	exp5
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.