VAMP5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	13 kDa
Gene Name	vesicle associated membrane protein 5
Database Link	NP_006625 Entrez Gene 10791 Human UniProt ID O95183
Background	Synaptobrevins/VAMPs, syntaxins, andThe 25-kD synaptosomal-associated protein areThe main components of a protein complex involved inThe docking and/or fusion of vesicles and cell membranes.The VAMP5 gene is a member ofThe vesicle-associated membrane protein (VAMP)/synaptobrevin family andThe SNARE superfamily.This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008]
Synonyms	MYOBREVIN; myobrevin; vesicle-associated membrane protein 5; vesicle-associated membrane protein 5 (myobrevin)
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane
Protein Pathways	SNARE interactions in vesicular transport

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.