CREB3L2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	cAMP responsive element binding protein 3-like 2
Database Link	NP_919047 Entrez Gene 64764 Human UniProt ID Q70SY1
Background	CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
Synonyms	BBF2H7
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 87%; Rat: 87%; Horse: 87%; Rabbit: 87%; Guinea pig: 87%; Mouse: 86%; Dog: 85%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	Huntington's disease, Melanogenesis, Prostate cancer

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.