KLHL13 Rabbit Polyclonal Antibody

CAT#: TA337273

Rabbit Polyclonal Anti-KLHL13 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human kelch-like 13 (Drosophila) (KLHL13), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of kelch-like 13 (Drosophila) (KLHL13), transcript variant 2
    • 100 ug

CNY 3,080.00


Recombinant protein of human kelch-like 13 (Drosophila) (KLHL13), 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of kelch-like 13 (Drosophila) (KLHL13), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KLHL13 antibody: synthetic peptide directed towards the N terminal of human KLHL13. Synthetic peptide located within the following region: KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 74 kDa
Gene Name kelch like family member 13
Background KLHL13 contains 6 Kelch repeats and 1 BTB (POZ) domain. The function of this protein remains unknown
Synonyms BKLHD2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Pathways Ubiquitin mediated proteolysis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...