SUV420h1 (KMT5B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	IHC, WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SUV420H1 Antibody: synthetic peptide directed towards the middle region of human SUV420H1. Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	99 kDa
Gene Name	lysine methyltransferase 5B
Database Link	NP_057112 Entrez Gene 51111 Human UniProt ID Q4FZB7
Background	SUV420H1 is a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined.
Synonyms	CGI-85; CGI85; SUV420H1
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Mouse: 91%; Dog: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Lysine degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.