PSMB11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PSMB11 antibody is: synthetic peptide directed towards the C-terminal region of Human PSMB11. Synthetic peptide located within the following region: HVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAED
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	proteasome subunit beta 11
Database Link	NP_001093250 Entrez Gene 122706 Human UniProt ID A5LHX3
Background	Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1, beta-2), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i, beta-2i, and beta-5i, are induced by gamma-interferon and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells .
Synonyms	BETA5T
Note	Immunogen Sequence Homology: Human: 100%; Rat: 83%
Reference Data
Protein Pathways	Proteasome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.