PCMF (KCMF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KCMF1 Antibody: synthetic peptide directed towards the N terminal of human KCMF1. Synthetic peptide located within the following region: SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	potassium channel modulatory factor 1
Database Link	NP_064507 Entrez Gene 56888 Human UniProt ID Q9P0J7
Background	KCMF1 belongs to the KCMF1 family. It contains 1 C2H2-type zinc finger and 1 ZZ-type zinc finger. It has intrinsic E3 ubiquitin ligase activity and promotes ubiquitination.
Synonyms	DEBT91; FIGC; PCMF; ZZZ1
Note	Immunogen sequence homology: Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.