ODF3L2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ODF3L2 antibody is: synthetic peptide directed towards the C-terminal region of Human ODF3L2. Synthetic peptide located within the following region: IPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	outer dense fiber of sperm tails 3 like 2
Database Link	NP_872383 Entrez Gene 284451 Human UniProt ID Q3SX64
Background	The function of this protein remains unknown.
Synonyms	C19orf19
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Horse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.