Meaf6 (NM_027310) Mouse Recombinant Protein
CAT#: TP524817
Purified recombinant protein of Mouse MYST/Esa1-associated factor 6 (Meaf6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR224817 representing NM_027310
Red=Cloning site Green=Tags(s) MAMHNKTAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKN SNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPAQEDP EDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRMNVSPQTGWHQLHL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081586 |
Locus ID | 70088 |
UniProt ID | Q2VPQ9 |
Refseq Size | 1070 |
Cytogenetics | 4 D2.2 |
Refseq ORF | 576 |
Synonyms | 2310005N01Rik; 2810036M01Rik |
Summary | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |