Nfe2 (NM_008685) Mouse Recombinant Protein
CAT#: TP505777
Purified recombinant protein of Mouse nuclear factor, erythroid derived 2 (Nfe2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205777 representing NM_008685
Red=Cloning site Green=Tags(s) MPPCPPQQNRNRLSQLPVGELGEMELTWQEIMSITELQGLNVPSETSFEPQAPTPYPGPLPPPTYCPCSI HPDAGFSLPPPSYELPASTPHVPELPYSYGNVAIPVSKPLTLSGLLNEPLPDHLALLDIGLPVGQPKPQE DPESDSGLSLNYSDAESLELEGMEAGRRRSEYADMYPVEYPYSLMPNSLAHPNYTLPPTETPLALESSSG PVRAKPAVRGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLAQYPLTESQLALVRDIRRRGKNKVAA QNCRKRKLETIVQLERELERLSSERERLLRARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEY VLQQAADGAIFLVPRGTKMEATD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 42 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032711 |
Locus ID | 18022 |
UniProt ID | Q07279, A0A0R4J0Y5 |
Refseq Size | 1793 |
Cytogenetics | 15 58.62 cM |
Refseq ORF | 1119 |
Synonyms | NF-E2; NF-E2/P45; p45; p45nf-e2; p45NFE2 |
Summary | Component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. Binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. Requires MAFK or other small MAF proteins for binding to the NF-E2 motif. May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |