Polr2m (NM_001164793) Mouse Recombinant Protein

CAT#: TP505631

Purified recombinant protein of Mouse polymerase (RNA) II (DNA directed) polypeptide M (Polr2m), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205631 protein sequence
Red=Cloning site Green=Tags(s)

MFSLPRGFEPPAPEDLGRQSSAELRERLRRQERLLRNEKFICKLPDKGKKISDTVAKLKAAISEREEVRG
RSELFHPVSVDCKLRQKATTRADTDVDKAQSSDLMLDTSSLVPDCSSIDIKSSKSTSETQGPTHLTHRGN
EETLEAGYTVNSSPAAHIRARAPSSEVKEHLPQHSVSSQEEEISSSIDSLFITKLQKITIADQSEPSEEN
TSTENFPELQSETPKKPHYMKVLEMRARNPVPPPHKFKTNVLPTQQSDSPSHCQRGQSPASSEERRRRAR
QHLDDITAARLLPLHHLPAQLLSIEESLALQREQKQNYEEMQAKLAAQKLAERLNIKMQSYNPEGESSGR
YREVRDEADAQSSDEC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001158265
Locus ID 28015
UniProt ID Q6P6I6
Refseq Size 2189
Cytogenetics 9 39.85 cM
Refseq ORF 1101
Synonyms AA407243; AA408799; AI303746; AW553238; D9Wsu138e; Grinl1a; mKIAA4185
Summary Isoform 1 appears to be stable component of the Pol II(G) complex form of RNA polymerase II. Pol II synthesizes mRNA precursors and many functional non-coding RNAs and is the central component of the basal RNA polymerase II transcription machinery. Isoform 1 may play a role in Mediator-dependent regulation of transcription activation. Isoform 1 acts in vitro as negative regulator of transcriptional activation; this repression is relieved by the Mediator complex, which restores Pol II(G) activator-dependent transcription to a level equivalent to that of Pol II (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...