Gatsl3 (NM_028022) Mouse Recombinant Protein

CAT#: TP504886

Purified recombinant protein of Mouse cytosolic arginine sensor for mTORC1 subunit 1 (Castor1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204886 protein sequence
Red=Cloning site Green=Tags(s)

MELHILEHRVRVLSIARPGLWLYTHPLIKLLFLPCRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQ
VAEATWLVMNVSHSGSVVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEF
QIYREVGGEPVPVTGDDSSNGFPQIQHGPSPTVHPIQSPQNRFCVLTLDPETLPAVATTLIDVLFYSHSV
PKEAASGGPESTSIPFFAFSLIEGYISIVMDAEIQRKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIV
AQIAGPLAAVDISAYYISTFNFDHALVPEDEIGCVIDILQRRQESQASKDP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082298
Locus ID 71962
UniProt ID Q9CWQ8
Refseq Size 1570
Cytogenetics 11 A1
Refseq ORF 996
Synonyms 2410008K03Rik; Castor1
Summary Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...