Pdlim4 (NM_019417) Mouse Recombinant Protein

CAT#: TP504849

Purified recombinant protein of Mouse PDZ and LIM domain 4 (Pdlim4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204849 protein sequence
Red=Cloning site Green=Tags(s)

MTHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRIK
GCHDHLTLSVSRPENKNWPSAPDDKAQAHRIHIDPESQDCSPATSRRSSVSGISLEDNRSGLGSPYGQPP
RLPVPHNGSSNEATLPAQMSALHVSPPTSADTARVLPRNRDCRVDLGSEVYRMLREPAEPTASEPKQSGS
FRYLQGMLEAGEGGDRPGSGGPRNLKPAASKLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFM
CSDCGLNLKQRGYFFLDERLYCENHAKARVKPPEGYDVVAVYPNAKVELV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062290
Locus ID 30794
UniProt ID P70271
Refseq Size 1189
Cytogenetics 11 32.13 cM
Refseq ORF 993
Synonyms Ril
Summary Suppresses SRC activation by recognizing and binding to active SRC and facilitating PTPN13-mediated dephosphorylation of SRC 'Tyr-419' leading to its inactivation. Inactivated SRC dissociates from this protein allowing the initiation of a new SRC inactivation cycle. Involved in reorganization of the actin cytoskeleton (By similarity). In nonmuscle cells, binds to ACTN1 (alpha-actinin-1), increases the affinity of ACTN1 to F-actin (filamentous actin), and promotes formation of actin stress fibers. Involved in regulation of the synaptic AMPA receptor transport in dendritic spines of hippocampal pyramidal neurons directing the receptors toward an insertion at the postsynaptic membrane. Links endosomal surface-internalized GRIA1-containing AMPA receptors to the alpha-actinin/actin cytoskeleton. Increases AMPA receptor-mediated excitatory postsynaptic currents in neurons (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...