Frg1 (NM_013522) Mouse Recombinant Protein

CAT#: TP503335

Purified recombinant protein of Mouse FSHD region gene 1 (Frg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
Rabbit Polyclonal Anti-Frg1 Antibody
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203335 protein sequence
Red=Cloning site Green=Tags(s)

MAEYSYVKSTKLVLKGTKAKSKKKKSKDKKRKREEDEETQLDIVGIWWTVSNFGEISGTIAIEMDKGAYI
HALDNGLFTLGAPHREVDEGPSPPEQFTAVKLSDSRIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEP
VFQDGKMALLASNSCFIRCNEAGDIEAKNKTAGEEEMIKIRSCAERETKKKDDIPEEDKGSVKQCEINYV
KKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_038550
Locus ID 14300
UniProt ID P97376
Refseq Size 1106
Cytogenetics 8 23.89 cM
Refseq ORF 777
Summary Binds to mRNA in a sequence-independent manner. May play a role in regulation of pre-mRNA splicing or in the assembly of rRNA into ribosomal subunits. May be involved in mRNA transport. May be involved in epigenetic regulation of muscle differentiation through regulation of activity of the histone-lysine N-methyltransferase KMT5B.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...