Frg1 (NM_013522) Mouse Recombinant Protein
CAT#: TP503335
Purified recombinant protein of Mouse FSHD region gene 1 (Frg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203335 protein sequence
Red=Cloning site Green=Tags(s) MAEYSYVKSTKLVLKGTKAKSKKKKSKDKKRKREEDEETQLDIVGIWWTVSNFGEISGTIAIEMDKGAYI HALDNGLFTLGAPHREVDEGPSPPEQFTAVKLSDSRIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEP VFQDGKMALLASNSCFIRCNEAGDIEAKNKTAGEEEMIKIRSCAERETKKKDDIPEEDKGSVKQCEINYV KKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 29.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_038550 |
Locus ID | 14300 |
UniProt ID | P97376 |
Refseq Size | 1106 |
Cytogenetics | 8 23.89 cM |
Refseq ORF | 777 |
Summary | Binds to mRNA in a sequence-independent manner. May play a role in regulation of pre-mRNA splicing or in the assembly of rRNA into ribosomal subunits. May be involved in mRNA transport. May be involved in epigenetic regulation of muscle differentiation through regulation of activity of the histone-lysine N-methyltransferase KMT5B.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |