Arl8a (NM_026823) Mouse Recombinant Protein
CAT#: TP501740
Purified recombinant protein of Mouse ADP-ribosylation factor-like 8A (Arl8a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201740 representing NM_026823
Red=Cloning site Green=Tags(s) MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLW DIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDE KELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081099 |
Locus ID | 68724 |
UniProt ID | Q8VEH3 |
Refseq Size | 1702 |
Cytogenetics | 1 E4 |
Refseq ORF | 558 |
Synonyms | 1110033P22Rik; Arl10b; gie2 |
Summary | Plays a role in lysosomes motility (PubMed:30174114). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (PubMed:30174114). May play a role in chromosome segregation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |