Ly6h (NM_001135689) Mouse Recombinant Protein

CAT#: TP501238

Purified recombinant protein of Mouse lymphocyte antigen 6 complex, locus H (Ly6h), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201238 protein sequence
Red=Cloning site Green=Tags(s)

MPAPQRTPACSPRASFRPYRSMLPAAMKSLGLALLALLLCPSPAHGLWCQDCTLANSSHCAPKQCQPTDT
VCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGASVAGRSP
WALAGGLLLSLGPALLWAGP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 17 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001129161
Locus ID 23934
UniProt ID Q9WUC3, Q8K356, Q544M1
Refseq Size 937
Cytogenetics 15 D3
Refseq ORF 483
Summary Believed to act as modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response (PubMed:26276394). May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface (PubMed:25716842). Seems to inhibit alpha-7/CHRNA7 signaling in hippocampal neurons (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...